Web Analytics
518-831-8000 sales@utechproducts.com

DEFB125, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant DEFB125, Each

1,757.70

Details:

Defensins are cysteine-rich cationic polypeptides that are important in the host immunologic response to invading microorganisms. The protein encoded by this gene is secreted and is a member of the beta defensin protein family. Beta defensin genes are found in several clusters throughout the genome, with this gene mapping to a cluster at 20p13. [provided by RefSeqSequence: PVSMLNDLITFDTTKFGETMTPETNTPETTMPPSEATTPETTMPPSETATSETMPPPSQTALTHN

Additional Information

SKU 10289866
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24006