Web Analytics
518-831-8000 sales@utechproducts.com

DGCR2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant DGCR2, Each

1,757.70

Details:

Deletions of the 22q11.2 have been associated with a wide range of developmental defects (notably DiGeorge syndrome, velocardiofacial syndrome, conotruncal anomaly face syndrome and isolated conotruncal cardiac defects) classified under the acronym CATCH 22. The DGCR2 gene encodes a novel putative adhesion receptor protein, which could play a role in neural crest cells migration, a process which has been proposed to be altered in DiGeorge syndrome. [provided by RefSeqSequence: RFSRKCPTGWHHYEGTASCYRVYLSGENYWDAAQTCQRLNGSLATFSTDQELRFVLAQEWDQPERSFGWKDQRKLWVGYQYVITGRNRSLEGRWEVAFKGSSEVFLPPDPIFASAMSENDNVFCAQLQCFHFPTLRHHDLHSWHAESCYEKSSFLCKRSQTCVDIKDNVVDEGFYFTPK

Additional Information

SKU 10287320
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21078