Dhx36 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Dhx36, Each

Details:

This gene is a member of the deah-box family of rna-dependent ntpases which are named after the conserved amino acid sequence asp-glu-ala-his in motif ii. The protein encoded by this gene has been shown to enhance the deadenylation and decay of mrnas with 3'-utr au-rich elements (are-mrna). The protein has also been shown to resolve into single strands the highly stable tetramolecular dna configuration (g4) that can form spontaneously in guanine-rich regions of dna. Alternative splicing results in multiple transcript variants encoding different isoforms. [Provided by refseqsequence: erreeqivqllnsvqakndkeseaqiswfapedhgygtevstkntpcsenkldiqekklinqekkmfrirnrsyidrdseyllqenepdgt