Dhx40, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Dhx40, Each

Details:

Ddx40 is a member of the dexh/d box family of atp-dependent rna helicases. Rna helicases catalyze the unwinding of double-stranded rna and play a role in rna metabolism, including pre-mrna splicing, ribosome biogenesis, and organellar gene expression.[Supplied by omimsequence: svgrtfctmdgrgspvhihpssalheqetklewiifhevlvttkvyarivcpiryewvrdllpklhefnahdlssvarrevredarrrwtnkenvkqlkdgiskdvlkkmqrrnddksisdararf