Web Analytics
518-831-8000 sales@utechproducts.com

DIAPH2 Rabbit anti-Human, Mouse, Rat, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant DIAPH2, Each

1,757.70

Details:

The product of this gene belongs to the diaphanous subfamily of the formin homology family of proteins. This gene may play a role in the development and normal function of the ovaries. Defects in this gene have been linked to premature ovarian failure 2. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeqSequence: GGSEEPGGGRSNKRSAGNRAANEEETKNKPKLNIQIKTLADDVRDRITSFRKSTVKKEKPLIQHPIDSQVAMSEFPAAQPLYDERSLNLSEKEVLDLFEKMMEDMNLNEEKKAPLRNKDFTTKREMVVQYISAT

Additional Information

SKU 10286654
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20307