Web Analytics
518-831-8000 sales@utechproducts.com

DLG2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant DLG2, Each

1,757.70

Details:

This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) family. The encoded protein forms a heterodimer with a related family member that may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins. Multiple transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been described, but their full-length nature is not known. [provided by RefSeqSequence: KVGKPTTIYMTDPYGPPDITHSYSPPMENHLLSGNNGTLEYKTSLPPISPGRYSPIPKHMLVDDDYTRPPEPVYSTVNKLCDKP

Additional Information

SKU 10287588
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21384