Web Analytics
518-831-8000 sales@utechproducts.com

DNAH11, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant DNAH11, Each

1,317.60

Details:

This gene encodes a member of the dynein heavy chain family. It is a microtubule-dependent motor ATPase and has been reported to be involved in the movement of respiratory cilia. Mutations in this gene have been implicated in causing Kartagener Syndrome (a combination of situs inversus totalis and Primary Ciliary Dyskinesia (PCD), also called Immotile Cilia Syndrome 1 (ICS1)) and male sterility. [provided by RefSeqSequence: VEEMLCNSFRMSAQMNRIATHLEIKNYQNDMDNMLGLAEVRQEIMNRVVNVINKVLDFRNTLETHTYLWVDDRAEFMKHFLLYGHAVS

Additional Information

SKU 10290127
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24455