Web Analytics
518-831-8000 sales@utechproducts.com

Dnajc24 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Dnajc24, Each

$ 1,757.70

Details

Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (eef2; mim 130610). This modification is conserved from archaebacteria to humans and serves as the target for adp-ribosylation and inactivation of eef2 by diphtheria toxin (dt) and pseudomonas exotoxin a. Dph4 is 1 of several enzymes involved in synthesis of diphthamide in eef2 (liu et al., 2004 [Pubmed 15485916]).[Supplied by omimsequence: lqrceddlrnvgpvdaqvyleemswnegdhsfylscrcggkysvskdeaeevsliscdtcsliiellhy

Additional Information

SKU 10287934
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21766