Web Analytics
518-831-8000 sales@utechproducts.com

Dnajc25-Gng10, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Dnajc25-Gng10, Each

1,757.70

Details

This gene represents naturally-occurring mrnas that are co-transcribed products of the neighboring dnajc25 and gng10 genes. These transcripts include the first exon of dnajc25 and the last two exons of gng10, resulting in a protein that combines the n-terminus of dnajc25 and the c-terminus of gng10. [Provided by refseqsequence: nikgkeygeeerlyiirksmkmsksqfdsledhqketflkrelwikenyevykqeqeeelkkklandprwkryrrwmknegpgrltfvdd

Additional Information

SKU 10291700
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB27473