Dnajc6, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Dnajc6, Each

Details:

Dnajc6 belongs to the evolutionarily conserved dnaj/hsp40 family of proteins, which regulate molecular chaperone activity by stimulating atpase activity. Dnaj proteins may have up to 3 distinct domains: a conserved 70-amino acid j domain, usually at the n terminus, a glycine/phenylalanine (g/f)-rich region, and a cysteine-rich domain containing 4 motifs resembling a zinc finger domain (ohtsuka and hata, 2000 [pubmed 11147971]).[Supplied by omimsequence: ngdkphgvkkpskkqqepaappppedvdllglegsamsnsfsppaapptnsellsdlfggggaagptqagqsgvedvfhpsgpastqstp