Web Analytics
518-831-8000 sales@utechproducts.com

DPRX, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant DPRX, Each

1,757.70

Details:

Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as the homeodomain. This gene is a member of the DPRX homeobox gene family. Evidence of mRNA expression has not yet been found for this gene. Multiple, related processed pseudogenes have been found which are thought to reflect expression of this gene in the germ line or embryonic cells. [provided by RefSeqSequence: GVSTSVGLRNADTLPRLPNAAHPIGLVYTGHRVPSFQLILYPNLKVPANDFIGHRIVHFGCCRDPNIYCLYPILESQVCAPSFHSGSPACSSNQSR

Additional Information

SKU 10292076
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28150