Web Analytics
518-831-8000 sales@utechproducts.com

DTD1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant DTD1, Each

1,757.70

Details:

The protein encoded by this gene is similar in sequence to histidyl-tRNA synthetase, which hydrolyzes D-tyrosyl-tRNA(Tyr) into D-tyrosine and free tRNA(Tyr). The encoded protein is found in the cytoplasm. [provided by RefSeqSequence: SVTVGGEQISAIGRGICVLLGISLEDTQKELEHMVRKILNLRVFEDESGKHWSKSVMDKQYEILCVSQFT

Additional Information

SKU 10289405
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23491