Web Analytics
518-831-8000 sales@utechproducts.com

DUS2L Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant DUS2L, Each

1,757.70

Details:

Dihydrouridine synthase catalyzes reduction of the 5,6-double bond of a uridine residue on the displacement loop of tRNA. The resultant modified base, 5,6-dihydrouridine, appears to increase the conformational flexibility and dynamic motion of tRNA (Kato et al., 2005 [PubMed 15994936]).[supplied by OMIMSequence: SLCYHNKLILAPMVRVGTLPMRLLALDYGADIVYCEELIDLKMIQCKRVVNEVLSTVDFVAPDDRVVFRTCEREQNRVVFQMGT

Additional Information

SKU 10291966
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB27928