Web Analytics
518-831-8000 sales@utechproducts.com

EAPP, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant EAPP, Each

1,757.70

Details:

This gene encodes a phosphoprotein that interacts with several members of the E2F family of proteins. The protein localizes to the nucleus, and is present throughout the cell cycle except during mitosis. It functions to modulate E2F-regulated transcription and stimulate proliferation. [provided by RefSeqSequence: VLLHGTPDQKRKLIRECLTGESESSSEDEFEKEMEAELNSTMKTMEDKLSSLGTGSSSGNGKVATAPTRYYDDIYFDSDSEDEDRAVQVTKKKKKKQHKIPTNDELLYDPE

Additional Information

SKU 10286505
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20139