Web Analytics
518-831-8000 sales@utechproducts.com

ECM1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ECM1, Each

1,757.70

Details:

This gene encodes an extracellular protein containing motifs with a cysteine pattern characteristic of the cysteine pattern of the ligand-binding ''double-loop'' domains of the albumin protein family. This gene maps outside of the epidermal differentiation complex (EDC), a cluster of three gene families involved in epidermal differentiation. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeqSequence: EDTLDKYCDREYAVKTHHHLCCRHPPSPTRDECFARRAPYPNYDRDILTIDIGRVTPNLMGHLCGNQRVLTKHKHIPGLIHNMTARCCDLPFPEQACCAEEEKLTFINDLCGPRRNIWRDPALCCYLSPGDEQVNCFNINYLRNVALVS

Additional Information

SKU 10288036
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21885