Web Analytics
518-831-8000 sales@utechproducts.com

EDARADD, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant EDARADD, Each

1,757.70

Details:

This gene was identified by its association with ectodermal dysplasia, a genetic disorder characterized by defective development of hair, teeth, and eccrine sweat glands. The protein encoded by this gene is a death domain-containing protein, and is found to interact with EDAR, a death domain receptor known to be required for the development of hair, teeth and other ectodermal derivatives. This protein and EDAR are coexpressed in epithelial cells during the formation of hair follicles and teeth. Through its interaction with EDAR, this protein acts as an adaptor, and links the receptor to downstream signaling pathways. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeqSequence: PTISDLLNDQDLLDVIRIKLDPCHPTVKNWRNFASKWGMSYDELCFLEQRPQSPTLEFLLRNSQRTVGQLMELCRLYHRADVEKVLRRWVDEEWPKRERGDP

Additional Information

SKU 10287292
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21049