Edem3 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Edem3, Each

Details:

Quality control in the endoplasmic reticulum (er) ensures that only properly folded proteins are retained in the cell through recognition and degradation of misfolded or unassembled proteins. Edem3 belongs to a group of proteins that accelerate degradation of misfolded glycoproteins in the er (hirao et al., 2006 [Pubmed 16431915]).[Supplied by omimsequence: ylyllfadkediifdiedyiftteahllplwlsttnqsiskknttseytelddsnfdwtcpntqilfpndplyaqsirepl