Emilin1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Emilin1, Each

Details:

This gene encodes an extracellular matrix glycoprotein that is characterized by an n-terminal microfibril interface domain, a coiled-coiled alpha-helical domain, a collagenous domain and a c-terminal globular c1q domain. The encoded protein associates with elastic fibers at the interface between elastin and microfibrils and may play a role in the development of elastic tissues including large blood vessels, dermis, heart and lung. [Provided by refseqsequence: pqsimyrrflrpryrvayktvtdmewrccqgyggddcaespapalgpasstprplarparpnlsgssagsplsglggegpgesekvqqleeqvqsltkelqglrgvlqglsgrlaedvqravetafngrqqpadaaarpgvhetlne