Eps15 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Eps15, Each

Details:

This gene encodes a protein that is part of the egfr pathway. The protein is present at clatherin-coated pits and is involved in receptor-mediated endocytosis of egf. Notably, this gene is rearranged with the hrx/all/mll gene in acute myelogeneous leukemias. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [Provided by refseqsequence: cffrqstdpfatsstdpfsaannssitsvetlkhndpfapggtvvaasdsatdpfasvfgnesfgggfadfstlskvnnedpfrsatsssvsnvvitknvfeetsvksedeppalppkigtptrpcplppgkrsinkldspd