Web Analytics
518-831-8000 sales@utechproducts.com

ERGIC1 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ERGIC1, Each

1,757.70

Details:

This gene encodes a cycling membrane protein which is an endoplasmic reticulum-golgi intermediate compartment (ERGIC) protein which interacts with other members of this protein family to increase their turnover. [provided by RefSeqSequence: PGNFHVSTHSATAQPQNPDMTHVIHKLSFGDTLQVQNIHGAFNALGGADRLTSNPLASHDYIL

Additional Information

SKU 10287410
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21178