Web Analytics
518-831-8000 sales@utechproducts.com

Etfdh, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Etfdh, Each

$ 1,757.70

Details

Electron-transferring-flavoprotein dehydrogenase in the inner mitochondrial membrane accepts electrons from electron-transfer flavoprotein which is located in the mitochondrial matrix and reduces ubiquinone in the mitochondrial membrane. The protein is synthesized as a 67kda precursor which is targeted to mitochondria and processed in a single step to a 64kda mature form located in the mitochondrial membrane. Deficiency in electron-transferring-flavoprotein dehydrogenase have been demonstrated in some patients with type ii glutaricacidemia. [Provided by refseqsequence: lavahekdirvclvekaaqigahtlsgacldpgafkelfpdwkekgaplntpvtedrfgiltekyripvpilpglpmn

Additional Information

SKU 10289765
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23884