F13a1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant F13a1, Each

Details:

This gene encodes the coagulation factor xiii a subunit. Coagulation factor xiii is the last zymogen to become activated in the blood coagulation cascade. Plasma factor xiii is a heterotetramer composed of 2 a subunits and 2 b subunits. The a subunits have catalytic function, and the b subunits do not have enzymatic activity and may serve as plasma carrier molecules. Platelet factor xiii is comprised only of 2 a subunits, which are identical to those of plasma origin. Upon cleavage of the activation peptide by thrombin and in the presence of calcium ion, the plasma factor xiii dissociates its b subunits and yields the same active enzyme, factor xiiia, as platelet factor xiii. This enzyme acts as a transglutaminase to catalyze the formation of gamma-glutamyl-epsilon-lysine crosslinking between fibrin molecules, thus stabilizing the fibrin clot. It also crosslinks alpha-2-plasmin inhibitor, or fibronectin, to the alpha chains of fibrin. Factor xiii deficiency is classified into two categories: type i deficiency, characterized by the lack of both the a and b subunits; and type ii deficiency, characterized by the lack of the a subunit alone. These defects can result in a lifelong bleeding tendency, defective wound healing, and habitual abortion. [Provided by refseqsequence: lnvtsvhlfkerwdtnkvdhhtdkyennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgkwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdt