Web Analytics
518-831-8000 sales@utechproducts.com

FAM219A, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant FAM219A, Each

1,757.70

Details:

The protein encoded by this gene has homologs that have been identified in mouse and macaque. The mouse and human proteins have a putative prenyl group binding site (CAAX box) at their C-terminus. A diverse list of proteins are known or strongly presumed to be the target of post-translational modification by the attachment of either a farnesyl or a geranyl-geranyl group to a cysteine residue at the C-terminus. The function of this protein has not been determined. [provided by RefSeqSequence: MEEIDRFQVPTAHSEMQPLDPAAASISDGDCDAREGESVAMNYKPSPLQVKLEKQRELARKGSLKNGSM

Additional Information

SKU 10287429
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21199