Web Analytics
518-831-8000 sales@utechproducts.com

FAM69A Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant FAM69A, Each

1,757.70

Details:

This gene may encode a transmembrane protein. Transcript variants of this gene may exist, but their full-length natures have not been determined. [provided by RefSeqSequence: GYNDKYDLKMVDMRKIVPETNLKELIKDRHCESDLDCVYGTDCRTSCDQSTMKCTSEVIQPNLAKACQLLKDYLLRGAPSEIREELEKQLYSCIALKVTANQMEMEHSLILNNL

Additional Information

SKU 10287114
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20838