Fbln2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Fbln2, Each
$ 1,757.70
|
|
Details:
This gene encodes an extracellular matrix protein, which belongs to the fibulin family. This protein binds various extracellular ligands and calcium. It may play a role during organ development, in particular, during the differentiation of heart, skeletal and neuronal structures. Alternatively spliced transcript variants encoding different isoforms have been identified. [Provided by refseqsequence: tlgsfhcykaltcepgyalkdgecedvdecamgthtcqpgflcqntkgsfycqarqrcmdgflqdpegncvdinectslsepcrpgfscintvgsytcqrnplicargyhasddgtkcvdvne
Additional Information
| SKU | 10292391 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28537 |
