Fbxo43 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Fbxo43, Each
$ 1,757.70
|
|
Details:
Members of the f-box protein family, such as fbxo43, are characterized by an approximately 40-amino acid f-box motif. Scf complexes, formed by skp1 (mim 601434), cullin (see cul1; mim 603134), and f-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with skp1 through the f box, and they interact with ubiquitination targets through other protein interaction domains (jin et al., 2004 [Pubmed 15520277]).[Supplied by omim]sequence: kgtpkvgdtirktrhlgrsrrlstlreqssqseteeekqivhpdsekraaaasaisegqlssdesgdltfslknlsktpalqlvhelfmkskrkrlqevd
Additional Information
| SKU | 10287851 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21675 |
