Web Analytics
518-831-8000 sales@utechproducts.com

Fcer1g, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Fcer1g, Each

1,757.70

Details:

The high affinity ige receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other fc receptors. [Provided by refseqsequence: kiqvrkaaitsyeksdgvytglstrnqetyetlkhekppq

Additional Information

SKU 10288005
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21846