Web Analytics
518-831-8000 sales@utechproducts.com

Fcn1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Fcn1, Each

1,757.70

Details

The ficolin family of proteins are characterized by the presence of a leader peptide, a short n-terminal segment, followed by a collagen-like region, and a c-terminal fibrinogen-like domain. The collagen-like and the fibrinogen-like domains are also found separately in other proteins such as complement protein c1q, c-type lectins known as collectins, and tenascins. However, all these proteins recognize different targets, and are functionally distinct. Ficolin 1 encoded by fcn1 is predominantly expressed in the peripheral blood leukocytes, and has been postulated to function as a plasma protein with elastin-binding activity. [Provided by refseqsequence: qgsselrvdlvdfegnhqfakyksfkvadeaekyklvlgafvggsagnsltghnnnffstkdqdndvsssncaekfqgawwyadchasnlnglylmgphesyanginws

Additional Information

SKU 10292293
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28407