Fez2 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Fez2, Each

Details:

This gene is an ortholog of the c. Elegans unc-76 gene, which is necessary for normal axonal bundling and elongation within axon bundles. Other orthologs include the rat gene that encodes zygin ii, which can bind to synaptotagmin. [Provided by refseqsequence: gsyeervkrlsvselneileeietaikeyseelvqqlalrdelefekevknsfisvlievqnkqkehketakkkkklkngssqngknershmpgtylttvipyekkngppsvedlqiltkilramkedsekvpslltdyil