Fgd1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Fgd1, Each

Details:

Fgd1 contains dbl (dh) and pleckstrin (ph) homology domains. It can bind specifically to the rho family gtpase cdc42hs and stimulate the gdp-gtp exchange of the isoprenylated form of cdc42hs. It also stimulates the mitogen activated protein kinase cascade leading to c-jun kinase sapk/jnk1 activation. Fgd1 has an essential role in embryonic development, and fgd1 gene mutations result in the human developmental disorder, aarskog-scott syndrome. [Provided by refseqsequence: dsdpgasepgllarrgsgsalggpldpqfvgpsdtslgaapghrvlpcgpspqhhralrfsyhlegsqprpglhqgnrilvkslsldpgqslephpegpqrlrsdp