Web Analytics
518-831-8000 sales@utechproducts.com

FLII Rabbit anti-Human, Mouse, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant FLII, Each

1,757.70

Details:

This gene encodes a protein with a gelsolin-like actin binding domain and an N-terminal leucine-rich repeat-protein protein interaction domain. The protein is similar to a Drosophila protein involved in early embryogenesis and the structural organization of indirect flight muscle. The gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeqSequence: YILDCWSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHATVSRSLEGTEAQVFKAKFKNWDDVLTVDYTRNAEAVLQSPGLSGKVKRDAEKKDQMKADLTALFLPRQPPMSLAEAEQLMEEWNEDL

Additional Information

SKU 10286790
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20459