Web Analytics
518-831-8000 sales@utechproducts.com

FMNL3, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant FMNL3, Each

1,757.70

Details:

The protein encoded by this gene contains a formin homology 2 domain and has high sequence identity to the mouse Wbp3 protein. Two alternative transcripts encoding different isoforms have been described. [provided by RefSeqSequence: LLDVKELGRGMELIRRECSIHDNSVLRNFLSTNEGKLDKLQRDAKTAEEAYNAVVRYFGESPKTTPPSVFFPVFVRFIRSYKEAEQENEARKKQEEVMREKQLAQEAKKLDAKTPSQRNKWQQQE

Additional Information

SKU 10292432
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28587