Fmnl3, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Fmnl3, Each
$ 1,757.70
|
|
Details:
The protein encoded by this gene contains a formin homology 2 domain and has high sequence identity to the mouse wbp3 protein. Two alternative transcripts encoding different isoforms have been described. [Provided by refseqsequence: lldvkelgrgmelirrecsihdnsvlrnflstnegkldklqrdaktaeeaynavvryfgespkttppsvffpvfvrfirsykeaeqenearkkqeevmrekqlaqeakkldaktpsqrnkwqqqe
Additional Information
| SKU | 10292432 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28587 |
