Web Analytics
518-831-8000 sales@utechproducts.com

GABRE, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant GABRE, Each

1,757.70

Details:

The product of this gene belongs to the ligand-gated ionic channel (TC 1.A.9) family. It encodes the gamma-aminobutyric acid (GABA) A receptor which is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes an epsilon subunit. It is mapped to chromosome Xq28 in a cluster comprised of genes encoding alpha 3, beta 4 and theta subunits of the same receptor. Alternatively spliced transcript variants have been identified, but only one is thought to encode a protein. [provided by RefSeqSequence: PQTESKNEASSRDVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPEASRILNTILSNYDHKLRPGIGEKPTVVTVEIAVNSLGPL

Additional Information

SKU 10290133
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24461