Gabre, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Gabre, Each

Details:

The product of this gene belongs to the ligand-gated ionic channel (tc 1.A.9) Family. It encodes the gamma-aminobutyric acid (gaba) a receptor which is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes an epsilon subunit. It is mapped to chromosome xq28 in a cluster comprised of genes encoding alpha 3, beta 4 and theta subunits of the same receptor. Alternatively spliced transcript variants have been identified, but only one is thought to encode a protein. [Provided by refseqsequence: pqteskneassrdvvygpqpqplenqllseetkstetetgsrvgklpeasrilntilsnydhklrpgigekptvvtveiavnslgpl