Web Analytics
518-831-8000 sales@utechproducts.com

GABRG1 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant GABRG1, Each

1,757.70

Details:

The protein encoded by this gene belongs to the ligand-gated ionic channel family. It is an integral membrane protein and plays an important role in inhibiting neurotransmission by binding to the benzodiazepine receptor and opening an integral chloride channel. This gene is clustered with three other family members on chromosome 4. [provided by RefSeqSequence: RGVRLVFLLLTLHLGNCVDKADDEDDEDLTVNKTWVLAPKIHEGDITQIL

Additional Information

SKU 10288724
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22690