Web Analytics
518-831-8000 sales@utechproducts.com

GAL3ST1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant GAL3ST1, Each

1,757.70

Details:

Sulfonation, an important step in the metabolism of many drugs, xenobiotics, hormones, and neurotransmitters, is catalyzed by sulfotransferases. The product of this gene is galactosylceramide sulfotransferase which catalyzes the conversion between 3'-phosphoadenylylsulfate a galactosylceramide to adenosine 3',5'-bisphosphate galactosylceramide sulfate. Activity of this sulfotransferase is enhanced in renal cell carcinoma. [provided by RefSeqSequence: LLNILFRFGQKHRLKFAFPNGRNDFDYPTFFARSLVQDYRPGACFNIICNHMRFHYDEVRGLVPTNAIFITVLRDPARLFESSFHYFGPVVPLTWKLSAGDKLTEFLQDPDRYYDPNGFNAHYLRNLLFFDLGYDNSLDPSSPQVQEHIL

Additional Information

SKU 10292282
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28396