Galnt8, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Galnt8, Each

Details:

This gene encodes a member of the udp-n-acetyl-alpha-d-galactosamine:polypeptide n-acetylgalactosaminyltransferase (galnac-t) family of enzymes. Galnac-ts initiate mucin-type o-linked glycosylation in the golgi apparatus by catalyzing the transfer of galnac to serine and threonine residues on target proteins. They are characterized by an n-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a gt1 motif and gal/galnac transferase motif, and a c-terminal ricin/lectin-like domain. Galnac-ts have different, but overlapping, substrate specificities and patterns of expression. [Provided by refseqsequence: nlldenvcldqgpfpgntpimyychefssqnvyyhltgelyvgqliaeasasdrcltdpgkaekptlepcskaaknrlhiywdfkpggavinrdtkrclemkkdllgshvlvlqtcstqvweiqhtvr