Web Analytics
518-831-8000 sales@utechproducts.com

GALNT8, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant GALNT8, Each

1,757.70

Details:

This gene encodes a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. [provided by RefSeqSequence: NLLDENVCLDQGPFPGNTPIMYYCHEFSSQNVYYHLTGELYVGQLIAEASASDRCLTDPGKAEKPTLEPCSKAAKNRLHIYWDFKPGGAVINRDTKRCLEMKKDLLGSHVLVLQTCSTQVWEIQHTVR

Additional Information

SKU 10286919
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20609