Web Analytics
518-831-8000 sales@utechproducts.com

GCAT, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant GCAT, Each

1,757.70

Details:

The degradation of L-threonine to glycine consists of a two-step biochemical pathway involving the enzymes L-threonine dehydrogenase and 2-amino-3-ketobutyrate coenzyme A ligase. L-Threonine is first converted into 2-amino-3-ketobutyrate by L-threonine dehydrogenase. This gene encodes the second enzyme in this pathway, which then catalyzes the reaction between 2-amino-3-ketobutyrate and coenzyme A to form glycine and acetyl-CoA. The encoded enzyme is considered a class II pyridoxal-phosphate-dependent aminotransferase. [provided by RefSeqSequence: CLASRYGALVFMDECHATGFLGPTGRGTDELLGVMDQVTIINSTLGKALGGASGGYTTGPGPLVSLLRQRARPYLFSNSLPPAVVGCASKALDLLMGSNTIVQSMAAKTQRFRSKMEAAGFTISGA

Additional Information

SKU 10287516
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21302