Web Analytics
518-831-8000 sales@utechproducts.com

Gcs1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Gcs1, Each

$ 1,757.70

Details

This gene encodes the first enzyme in the n-linked oligosaccharide processing pathway. The enzyme cleaves the distal alpha-1,2-linked glucose residue from the glc(3)-man(9)-glcnac(2) oligosaccharide precursor. This protein is located in the lumen of the endoplasmic reticulum. Defects in this gene are a cause of type iib congenital disorder of glycosylation (cdgiib). Two transcript variants encoding different isoforms have been found for this gene. [Provided by refseqsequence: leshaegfrerfektfqlkekglssgeqvlgqaalsgllggigyfygqglvlpdigvegseqkvdpalfppvplftavpsrsffprgflwdegfhqlvvqrwdpsltrealghwlgllnadgwig

Additional Information

SKU 10286892
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20575