Gemin5, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Gemin5, Each

Details:

Gemin5 is part of a large macromolecular complex localized to both the cytoplasm and the nucleus that plays a role in the cytoplasmic assembly of small nuclear ribonucleoproteins (snrnps). Other members of this complex include smn (mim 600354), gemin2 (sip1; mim 602595), gemin3 (ddx20; mim 606168), and gemin4 (mim 606969).[Supplied by omimsequence: ydsgsftimqevysaflpdgcdhlrdklgdhqspatpafksleafflygrlyefwwslsrpcpnssvwvraghrtlsvepsqqldtasteetdpet