Gfra3, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Gfra3, Each

Details:

The protein encoded by this gene is a glycosylphosphatidylinositol(gpi)-linked cell surface receptor and a member of the gdnf receptor family. It forms a signaling receptor complex with ret tyrosine kinase receptor and binds the ligand, artemin. [Provided by refseqsequence: lptesrlmnsclqarrkcqadptcsaayhhldsctssistplpseepsvpadcleaaqqlrnssligcmchrrmknqvacl