Web Analytics
518-831-8000 sales@utechproducts.com

Gins4 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Gins4, Each

$ 1,757.70

Details

The yeast heterotetrameric gins complex is made up of sld5, psf1 (gins1; mim 610608), psf2 (gins2; mim 610609), and psf3 (gins3; mim 610610). The formation of the gins complex is essential for the initiation of dna replication in yeast and xenopus egg extracts (ueno et al., 2005 [Pubmed 16287864]). See gins1 for additional information about the gins complex.[Supplied by omimsequence: mteevdflgqdsdggseevvltpaelierleqawmnekfapelleskpeivecvmeqlehmee

Additional Information

SKU 10287906
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21736