Web Analytics
518-831-8000 sales@utechproducts.com

Glis1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Glis1, Each

$ 1,313.48

Details

Glis1 is a gli (mim 165220)-related kruppel-like zinc finger protein that functions as an activator and repressor of transcription (kim et al., 2002 [Pubmed 12042312]).[Supplied by omimsequence: vlteclvlqqlhtstqlaasdgkggcglgqellpgvypgsitphnglasgllppahnvpsrhhpldattsshhhlsplpmaestrdglgpgllspivsplkglgppplppssqshspggqpfptlp

Additional Information

SKU 10286427
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20056