Web Analytics
518-831-8000 sales@utechproducts.com

GLT8D1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant GLT8D1, Each

1,757.70

Details:

This gene encodes a member of the glycosyltransferase family. The specific function of this protein has not been determined. Three alternatively spliced variants encoding the same isoform have been described. [provided by RefSeqSequence: VPNALRHAVDGRQEEIPVVIAASEDRLGGAIAAINSIQHNTRSNVIFYIVTLNNTADHLRSWLNSDSLKSIRYKIVNFDPKLLEGKVKEDPDQGESMKPLTFARFYLPILVPSAKKAIYMDDDVIVQG

Additional Information

SKU 10286826
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20501