Glt8d1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Glt8d1, Each
$ 1,757.70
|
|
Details:
This gene encodes a member of the glycosyltransferase family. The specific function of this protein has not been determined. Three alternatively spliced variants encoding the same isoform have been described. [Provided by refseqsequence: vpnalrhavdgrqeeipvviaasedrlggaiaainsiqhntrsnvifyivtlnntadhlrswlnsdslksirykivnfdpkllegkvkedpdqgesmkpltfarfylpilvpsakkaiymdddvivqg
Additional Information
| SKU | 10286826 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20501 |
