Web Analytics
518-831-8000 sales@utechproducts.com

Golim4 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Golim4, Each

$ 1,757.70

Details

The golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type ii golgi-resident protein. It may process proteins synthesized in the rough endoplasmic reticulum and assist in the transport of protein cargo through the golgi apparatus. [Provided by refseqsequence: ehleeehdpspeeqdrewkeqheqreaanllegharaevypsakpmikfqspyeeqleqqrlavqqveeaqqlrehqealhqqrlqghllrqqeqqqqqvaremalqrqaeleegrpqhqeqlrqqahydamdndivqgaed

Additional Information

SKU 10292357
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28477