Web Analytics
518-831-8000 sales@utechproducts.com

GOPC Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant GOPC, Each

1,757.70

Details:

PIST is a PDZ domain-containing Golgi protein. PDZ domains contain approximately 90 amino acids and bind the extreme C terminus of proteins in a sequence-specific manner.[supplied by OMIMSequence: IEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLY

Additional Information

SKU 10287816
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21636