Web Analytics
518-831-8000 sales@utechproducts.com

GPM6B, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant GPM6B, Each

1,757.70

Details:

This gene encodes a membrane glycoprotein that belongs to the proteolipid protein family. Proteolipid protein family members are expressed in most brain regions and are thought to be involved in cellular housekeeping functions, such as membrane trafficking and cell-to-cell communication. [provided by RefSeqSequence: AVPVFMFYNIWSTCEVIKSPQTNGTTGVEQICVDIRQYGIIPWNAFPGKICGSALENICNTNEFYMSYH

Additional Information

SKU 10286504
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20138