Web Analytics
518-831-8000 sales@utechproducts.com

Gprc5b Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Gprc5b, Each

$ 1,757.70

Details

The protein encoded by this gene is a member of the type 3 g protein-coupled receptor family. Members of this superfamily are characterized by a signature 7-transmembrane domain motif. The specific function of this protein is unknown; however, this protein may mediate the cellular effects of retinoic acid on the g protein signal transduction cascade. [Provided by refseqsequence: ihctllpalqentpnyfdtsqprmretafeedvqlpraymenkafsmdehnaalrtagfpngslgkrpsgslgkrpsapfrsnvyqptemavvlnggtiptap

Additional Information

SKU 10287084
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20805