Web Analytics
518-831-8000 sales@utechproducts.com

Gpsm2 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Gpsm2, Each

$ 1,757.70

Details

Heterotrimeric g proteins transduce extracellular signals received by cell surface receptors into integrated cellular responses. Gpsm2 belongs to a group of proteins that modulate activation of g proteins (blumer et al., 2002 [Pubmed 11832491]).[Supplied by omimsequence: fqsnrmddqrcclqeknchtastttsstppkmmlktssvpvvspntdefldllassqsrrlddqrasfsnlpglrltqnsqsvlshlmtndnkeadedffd

Additional Information

SKU 10286756
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20424