Web Analytics
518-831-8000 sales@utechproducts.com

GPSM2 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant GPSM2, Each

1,757.70

Details:

Heterotrimeric G proteins transduce extracellular signals received by cell surface receptors into integrated cellular responses. GPSM2 belongs to a group of proteins that modulate activation of G proteins (Blumer et al., 2002 [PubMed 11832491]).[supplied by OMIMSequence: FQSNRMDDQRCCLQEKNCHTASTTTSSTPPKMMLKTSSVPVVSPNTDEFLDLLASSQSRRLDDQRASFSNLPGLRLTQNSQSVLSHLMTNDNKEADEDFFD

Additional Information

SKU 10286756
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20424