Grhl1 Rabbit Anti-Human, Mouse, Rat, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Grhl1, Each
$ 1,757.70
|
|
Details:
This gene encodes a member of the grainyhead family of transcription factors. The encoded protein can exist as a homodimer or can form heterodimers with sister-of-mammalian grainyhead or brother-of-mammalian grainyhead. This protein functions as a transcription factor during development. [Provided by refseqsequence: tvfkpfidldtqpvlfipdvhfanlqrgthvlpiaseelegegsvlkrgpygteddfavppstklarieepkrvllyvrkeseevfdalmlktpslkgl
Additional Information
| SKU | 10286666 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20320 |
