Web Analytics
518-831-8000 sales@utechproducts.com

GSPT2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant GSPT2, Each

1,796.85

Details:

GSPT2 is closely related to GSPT1 (MIM 139259), a GTP-binding protein that plays an essential role at the G1- to S-phase transition of the cell cycle in yeast and human cells. GSPT1 is a positive regulator of translational accuracy and, in a binary complex with eRF1 (MIM 600285), functions as a polypeptide chain release factor.[supplied by OMIMSequence: TQPPTLPAGSGSNDETCTGAGYPQGKRMGRGAPVEPSREEPLVSLEGSNSAVT

Additional Information

SKU 10290041
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24359