Gspt2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Gspt2, Each

Details:

Gspt2 is closely related to gspt1 (mim 139259), a gtp-binding protein that plays an essential role at the g1- to s-phase transition of the cell cycle in yeast and human cells. Gspt1 is a positive regulator of translational accuracy and, in a binary complex with erf1 (mim 600285), functions as a polypeptide chain release factor.[Supplied by omimsequence: tqpptlpagsgsndetctgagypqgkrmgrgapvepsreeplvslegsnsavt